PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G21440.1
Common NameATM4, ATMYB102, MYB102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 350aa    MW: 40166.6 Da    PI: 6.9432
Description MYB-like 102
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G21440.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.1e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++lvd+++++G g+W+t ++  g+ R++k+c++rw +yl
      AT4G21440.1 14 KGPWTSEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.91.7e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      AT4G21440.1  67 RGRFSFEEEETIIQLHSFLGNK-WSAIAARLP-GRTDNEIKNFWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129424.632965IPR017930Myb domain
SuperFamilySSF466892.17E-3111108IPR009057Homeodomain-like
SMARTSM007175.5E-131363IPR001005SANT/Myb domain
PfamPF002493.5E-161461IPR001005SANT/Myb domain
CDDcd001675.89E-121661No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129419.23466116IPR017930Myb domain
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002496.6E-1567111IPR001005SANT/Myb domain
CDDcd001672.51E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009029anatomystamen
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MARSPCCEKN GLKKGPWTSE EDQKLVDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSFLGNKWS AIAARLPGRT DNEIKNFWNT HIRKKLLRMG  120
IDPVTHSPRL DLLDISSILA SSLYNSSSHH MNMSRLMMDT NRRHHQQHPL VNPEILKLAT  180
SLFSQNQNQN LVVDHDSRTQ EKQTVYSQTG VNQYQTNQYF ENTITQELQS SMPPFPNEAR  240
QFNNMDHHFN GFGEQNLVST STTSVQDCYN PSFNDYSSSN FVLDPSYSDQ SFNFANSVLN  300
TPSSSPSPTT LNSSYINSSS CSTEDEIESY CSNLMKFDIP DFLDVNGFII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306854360.0
Genevisible254413_at0.0
Expression AtlasAT4G21440-
AtGenExpressAT4G21440-
ATTED-IIAT4G21440-
Functional Description ? help Back to Top
Source Description
TAIREncodes a MYB transcription factor involved in wounding and osmotic stress response. Member of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G21440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G21440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196070.0AY519607.1 Arabidopsis thaliana MYB transcription factor (At4g21440) mRNA, complete cds.
GenBankBT0012350.0BT001235.1 Arabidopsis thaliana myb-related protein M4 (At4g21440) mRNA, complete cds.
GenBankX903820.0X90382.2 Arabidopsis thaliana mRNA for putative transcription factor (MYB102 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567626.10.0R2R3 family MYB transcription factor
TrEMBLQ9LDR80.0Q9LDR8_ARATH; MYB transcription factor
STRINGAT4G21440.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Denekamp M,Smeekens SC
    Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.
    Plant Physiol., 2003. 132(3): p. 1415-23
    [PMID:12857823]
  4. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Catala R, et al.
    The Arabidopsis E3 SUMO ligase SIZ1 regulates plant growth and drought responses.
    Plant Cell, 2007. 19(9): p. 2952-66
    [PMID:17905899]
  7. De Vos M, et al.
    The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.
    Plant Signal Behav, 2006. 1(6): p. 305-11
    [PMID:19517001]
  8. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  9. Quaedvlieg N, et al.
    Identification of a light-regulated MYB gene from an Arabidopsis transcription factor gene collection.
    Plant Mol. Biol., 1996. 32(5): p. 987-93
    [PMID:8980549]